• Product NameRecombinant human SPARC protein
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:18-303aa
  Sequence Info:Full Length
• Alternative Names    Basement-membrane protein 40 ;BM-40Osteonectin ;ONSecreted protein acidic and rich in cysteine
• Accession No. P09486
• UniprotP09486
• Gene ID6678;
• Calculated MW 59.7 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence APQQEALPDETEVVEETVAEVTEVSVGANPVQVEVGEFDDGAEETEEEVVAENPCQNHHCKHGKVCELDENNTPMCVCQDPTSCPAPIGEFEKVCSNDNKTFDSSCHFFATKCTLEGTKKGHKLHLDYIGPCKYIPPCLDSELTEFPLRMRDWLKNVLVTLYERDEDNNLLTEKQKLRVKKIHENEKRLEAGDHPVELLARDFEKNYNMYIFPVHWQFGQLDQHPIDGYLSHTELAPLRAPLIPMEHCTTRFFETCDLDNDKYIALDEWAGCFGIKQKDIDKDLVI
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Appears to regulate cell growth through interactions with the Extracellular domain matrix and cytokines. Binds calcium and copper, several types of collagen, albumin, thrombospondin, PDGF and cell mbranes. There are two calcium binding sites; an acidic domain that binds 5 to 8 Ca2+ with a low affinity and an EF-hand loop that binds a Ca2+ ion with a high affinity.

"Structure of human osteonectin based upon analysis of cDNA and genomic sequences."Villarreal X.C., Mann K.G., Long G.L.Biochemistry 28:6483-6491(1989)
Research Topic:Cardiovascular

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting