- Product NameRecombinant human Growth/differentiation factor 15 protein
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:198-308aa
Sequence Info:Full Length - Alternative Names Macrophage inhibitory cytokine 1 ;MIC-1NSAID-activated gene 1 protein ;NAG-1NSAID-regulated gene 1 protein ;NRG-1;Placental TGF-betaPlacental bone morphogenetic protein;Prostate differentiation factor
- Accession No. Q99988
- UniprotQ99988
- Gene ID9518;
- Calculated MW 16.2 kDa
- Tag Info N-terminal 6xHis-tagged
- Target Sequence RNGDHCPLGPGRCCRLHTVRASLEDLGWADWVLSPREVQVTMCIGACPSQFRAANMHAQIKTSLHRLKPDTVPAPCCVPASYNPMVLIQKTDTGVSLQTYDDLLAKDCHCI
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
