• Product NameRecombinant human Metalloproteinase inhibitor 3 protein
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:30-208aa
  Sequence Info:Partial
• Alternative Names    Protein MIG-5Tissue inhibitor of metalloproteinases 3 ;TIMP-3
• Accession No. P35625
• UniprotP35625
• Gene ID7078;
• Calculated MW 24.8 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence HPQDAFCNSDIVIRAKVVGKKLVKEGPFGTLVYTIKQMKMYRGFTKMPHVQYIHTEASESLCGLKLEVNKYQYLLTGRVYDGKMYTGLCNFVERWDQLTLSQRKGLNYRYHLGCNCKIKSCYYLPCFVTSKNECLWTDMLSNFGYPGYQSKHYACIRQKGGYCSWYRGWAPPDKSIINA
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Complexes with metalloproteinases (such as collagenases) and irreversibly inactivates th by binding to their catalytic zinc cofactor. May form part of a tissue-specific acute response to rodeling stimuli. Known to act on MMP-1, MMP-2, MMP-3, MMP-7, MMP-9, MMP-13, MMP-14 and MMP-15.

Structure and expression in breast tumors of human TIMP-3, a new member of the metalloproteinase inhibitor family.Uria J.A., Ferrando A.A., Velasco G., Freije J.M., Lopez-Otin C.Cancer Res. 54:2091-2094(1994)
Research Topic:Neuroscience

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting