• Product NameRecombinant human Basigin
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:138-321aa
  Sequence Info:Partial
• Alternative Names    5F7Collagenase stimulatory factorExtracellular domain matrix metalloproteinase inducer ;EMMPRINLeukocyte activation antigen M6OK blood group antigen;Tumor cell-derived collagenase stimulatory factor ;TCSF; CD147
• Accession No. P35613
• UniprotP35613
• Gene ID682;
• Calculated MW 24.2 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence EPGTVFTTVEDLGSKILLTCSLNDSATEVTGHRWLKGGVVLKEDALPGQKTEFKVDSDDQWGEYSCVFLPEPMGTANIQLHGPPRVKAVKSSEHINEGETAMLVCKSESVPPVTDWAWYKITDSEDKALMNGSESRFFVSSSQGRSELHIENLNMEADPGQYRCNGTSSKGSDQAIITLRVRSH
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Plays an important role in targeting the monocarboxylate transporters SLC16A1, SLC16A3 and SLC16A8 to the plasma mbrane. Plays pivotal roles in spermatogenesis, bryo implantation, neural network formation and tumor progression. Stimulates adjacent fibroblasts to produce matrix metalloproteinases (MMPS). Ses to be a receptor for oligomannosidic glycans. In vitro, promotes outgrowth of astrocytic processes.

Characterization of basigin isoforms and the inhibitory function of basigin-3 in human hepatocellular carcinoma proliferation and invasion.Liao C.G., Kong L.M., Song F., Xing J.L., Wang L.X., Sun Z.J., Tang H., Yao H., Zhang Y., Wang L., Wang Y., Yang X.M., Li Y., Chen Z.N.Mol. Cell. Biol. 31:2591-2604(2011)
Research Topic:Cancer

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting