• Product NameRecombinant human V-set domain-containing T-cell activation inhibitor 1
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:26-258aa
  Sequence Info:Partial
• Alternative Names    B7 homolog 4 ;B7-H4B7h.5Immune costimulatory protein B7-H4Protein B7S1T-cell costimulatory molecule B7x
• Accession No. Q7Z7D3
• UniprotQ7Z7D3
• Gene ID79679;
• Calculated MW 52.6 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence IIGFGISGRHSITVTTVASAGNIGEDGILSCTFEPDIKLSDIVIQWLKEGVLGLVHEFKEGKDELSEQDEMFRGRTAVFADQVIVGNASLRLKNVQLTDAGTYKCYIITSKGKGNANLEYKTGAFSMPEVNVDYNASSETLRCEAPRWFPQPTVVWASQVDQGANFSEVSNTSFELNSENVTMKVVSVLYNVTINNTYSCMIENDIAKATGDIKVTESEIKRRSHLQLLNSKA
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Negatively regulates T-cell-mediated immune response by inhibiting T-cell activation, proliferation, cytokine production and development of cytotoxicity. When expressed on the cell surface of tumor macrophages, plays an important role, together with regulatory T-cells (Treg), in the suppression of tumor-associated antigen-specific T-cell immunity. Involved in promoting epithelial cell transformation.

B7-H4, a molecule of the B7 family, negatively regulates T cell immunity.Sica G.L., Choi I.-H., Zhu G., Tamada K., Wang S.-D., Tamura H., Chapoval A.I., Flies D.B., Bajorath J., Chen L.Immunity 18:849-861(2003)
Research Topic:Immunology

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting