• Product NameRecombinant human GTPase KRas
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:2-168aa
  Sequence Info:Partial
• Alternative Names    K-Ras 2Ki-Rasc-K-rasc-Ki-ras
• Accession No. P01116
• UniprotP01116
• Gene ID3845;
• Calculated MW 23.1 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence TEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKCDLPSRTVDTKQAQDLARSYGIPFIETSAKTRQRVEDAFYTLVREIRQYRL
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Ras proteins bind GDP,GTP and possess intrinsic GTPase activity. Plays an important role in the regulation of cell proliferation .Curated2 Publications

Structure and organization of the human Ki-ras proto-oncogene and a related processed pseudogene.McGrath J.P., Capon D.J., Smith D.H., Chen E.Y., Seeburg P.H., Goeddel D.V., Levinson A.D.Nature 304:501-506(1983)
Research Topic:Epigenetics and Nuclear Signaling

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting