• Product NameRecombinant rat Beta-nerve growth factor
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:124-241aa
  Sequence Info:Partial
• Accession No. P25427
• UniprotP25427
• Gene ID310738;
• Calculated MW 17.2 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence THPVFHMGEFSVCDSVSVWVGDKTTATDIKGKEVTVLGEVNINNSVFKQYFFETKCRAPNPVESGCRGIDSKHWNSYCTTTHTFVKALTTDDKQAAWRFIRIDTACVCVLSRKAARRG
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Nerve growth factor is important for the development and maintenance of the sympathetic and sensory nervous systs. Extracellular domain ligand for the NTRK1 and NGFR receptors, activates cellular signaling cascades through those receptor tyrosine kinase to regulate neuronal proliferation, differentiation and survival. Inhibits metalloproteinase dependent proteolysis of platelet glycoprotein VI.

Rat beta-nerve growth factor sequence and site of synthesis in the adult hippocampus.Whittemore S.R., Friedman P.L., Larhammar D.G., Persson H., Gonzalez-Carvajal M., Holets V.R.J. Neurosci. Res. 20:403-410(1988)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting