- Product NameRecombinant Homo sapiens CMRF35-like molecule 7
- Brief DescriptionRecombinant Protein
- Host SpeciesYeast
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:18-151aa
Sequence Info:Full Length - Alternative Names CD300 antigen-like family member B CMRF35-A2 Immune receptor expressed on myeloid cells 3 Short name: IREM-3 Leukocyte mono-Ig-like receptor 5 Triggering receptor expressed on myeloid cells 5 Short name: TREM-5 CD_antigen: CD300b
- Accession No. A8K4G0
- UniprotA8K4G0
- Gene ID124599;
- Calculated MW 17.2 kDa
- Tag Info N-terminal 6xHis-tagged
- Target Sequence IQGPESVRAPEQGSLTVQCHYKQGWETYIKWWCRGVRWDTCKILIETRGSEQGEKSDRVSIKDNQKDRTFTVTMEGLRRDDADVYWCGIERRGPDLGTQVKVIVDPEGAASTTASSPTNSNMAVFIGSHKRNHY
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
