• Product NameRecombinant Mus musculus Chymotrypsin-like elastase family member 2A
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:31-271aa
  Sequence Info:Full Length
• Alternative Names    Elastase-2 Elastase-2A
• Accession No. P05208
• UniprotP05208
• Gene ID13706;
• Calculated MW 27.7 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence VVGGQEATPNTWPWQVSLQVLSSGRWRHNCGGSLVANNWVLTAAHCLSNYQTYRVLLGAHSLSNPGAGSAAVQVSKLVVHQRWNSQNVGNGYDIALIKLASPVTLSKNIQTACLPPAGTILPRNYVCYVTGWGLLQTNGNSPDTLRQGRLLVVDYATCSSASWWGSSVKSSMVCAGGDGVTSSCNGDSGGPLNCRASNGQWQVHGIVSFGSSLGCNYPRKPSVFTRVSNYIDWINSVMARN
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Acts upon elastin.

"Wnk1 kinase deficiency lowers blood pressure in mice: a gene-trap screen to identify potential targets for therapeutic intervention." Zambrowicz B.P., Abuin A., Ramirez-Solis R., Richter L.J., Piggott J., BeltrandelRio H., Buxton E.C., Edwards J., Finch R.A., Friddle C.J., Gupta A., Hansen G., Hu Y., Huang W., Jaing C., Key B.W. Jr., Kipp P., Kohlhauff B. Sands A.T.Proc. Natl. Acad. Sci. U.S.A. 100:14109-14114(2003)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting