• Product NameRecombinant Mus musculus Histone H3-like centromeric protein A
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-134aa
  Sequence Info:Full Length
• Alternative Names    Centromere protein A ;CENP-A
• Accession No. O35216
• UniprotO35216
• Gene ID12615;
• Calculated MW 17.5 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence MGPRRKPQTPRRRPSSPAPGPSRQSSSVGSQTLRRRQKFMWLKEIKTLQKSTDLLFRKKPFSMVVREICEKFSRGVDFWWQAQALLALQEAAEAFLIHLFEDAYLLSLHAGRVTLFPKDIQLTRRIRGFEGGLP
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Histone H3-like variant which exclusively replaces conventional H3 in the nucleosome core of centromeric chromatin at the inner plate of the kinetochore. Required for recruitment and assbly of kinetochore proteins, mitotic progression and chromosome segregation. May serve as an epigenetic mark that propagates centromere identity through replication and cell division. The CENPA-H4 heterotetramer can bind DNA by itself (in vitro) .

Gene structure and sequence analysis of mouse centromere proteins A and C.Kalitsis P., Macdonald A.C., Newson A.J., Hudson D.F., Choo K.H.A.Genomics 47:108-114(1998)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting