- Product NameRecombinant Homo sapiens C-X-C motif chemokine 10
- Brief DescriptionRecombinant Protein
- Host SpeciesYeast
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:22-98aa
Sequence Info:Full Length - Alternative Names 10KDA interferon gamma-induced protein ;Gamma-IP10 ;IP-10Small-inducible cytokine B10
- Accession No. P02778
- UniprotP02778
- Gene ID3627;
- Calculated MW 10.6 kDa
- Tag Info N-terminal 6xHis-tagged
- Target Sequence VPLSRTVRCTCISISNQPVNPRSLEKLEIIPASQFCPRVEIIATMKKKGEKRCLNPESKAIKNLLKAVSKERSKRSP
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
