• Product NameRecombinant human High affinity immunoglobulin epsilon receptor subunit gamma
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:45-86aa
  Sequence Info:Cytoplasmic Domain
• Alternative Names    Fc receptor gamma-chain ;FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma ;FceRI gamma
• Accession No. P30273
• UniprotP30273
• Gene ID2207;
• Calculated MW 6.9 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence RLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.

Characterization and expression of the gene for the human Fc receptor gamma subunit. Definition of a new gene family.Kuester H., Thompson H., Kinet J.-P.J. Biol. Chem. 265:6448-6452(1990)
Research Topic:Immunology

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting