- Product NameRecombinant Leukocyte immunoglobulin-like receptor subfamily A member 5
- Brief DescriptionRecombinant Protein
- Host SpeciesYeast
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:42-268aa
Sequence Info:Extracellular Domain - Alternative Names CD85 antigen-like family member FImmunoglobulin-like transcript 11 ;ILT-11Leukocyte immunoglobulin-like receptor 9 ;LIR-9; CD85f
- Accession No. A6NI73
- UniprotA6NI73
- Gene ID353514;
- Calculated MW 27.2 kDa
- Tag Info N-terminal 6xHis-tagged
- Target Sequence GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
