• Product NameRecombinant Canis familiaris Matrix metalloproteinase-9
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:107-704aa
  Sequence Info:Full Length
• Alternative Names    92KDA gelatinase92KDA type IV collagenaseGelatinase B ;GELB
• Accession No. O18733
• UniprotO18733
• Calculated MW 68.3 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence FQTFEGDLKWHHNDITYWIQNYSEDLPRDVIDDAFARAFAVWSAVTPLTFTRVYGPEADIIIQFGVREHGDGYPFDGKNGLLAHAFPPGPGIQGDAHFDDEELWTLGKGVVVPTHFGNADGAPCHFPFTFEGRSYSACTTDGRSDDTPWCSTTADYDTDRRFGFCPSEKLYAQDGNGDGKPCVFPFTFEGRSYSTCTTDGRSDGYRWCSTTADYDQDKLYGFCPTRVDSAVTGGNSAGEPCVFPFIFLGKQYSTCTREGRGDGHLWCATTSNFDRDKKWGFCPDQGYSLFLVAAHEFGHALGLDHSSVPEALMYPMYSFTEGPPLHEDDVRGIQHLYGPRPEPEPQPPTAPPTAPPTVCATGPPTTRPSERPTAGPTGPPAAGPTGPPTAGPSEAPTVPVDPAEDICKVNIFDAIAEIRNYLHFFKEGKYWRFSKGKGRRVQGPFLSPSTWPALPRKLDSAFEDGLTKKTFFFSGRQVWVYTGTSVVGPRRLDKLGLGPEVTQVTGALPQGGGKVLLFSRQRFWSFDVKTQTVDPRSAGSVEQMYPGVPLNTHDIFQYQEKAYFCQDRFYWRVNSRNEVNQVDEVGYVTFDILQCPED
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Could play a role in bone osteoclastic resorption. Cleaves type IV and type V collagen into large C-terminal three quarter fragments and shorter N-terminal one quarter fragments .

Dog mast cell alpha-chymase activates progelatinase B by cleaving the Phe88-Gln89 and Phe91-Glu92 bonds of the catalytic domain.Fang K.C., Raymond W.W., Blount J.L., Caughey G.H.J. Biol. Chem. 272:25628-25635(1997)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting