• Product NameRecombinant rat Myosin-binding protein C, cardiac-type
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:645-864aa
  Sequence Info:Partial
• Alternative Names    C-protein, cardiac muscle isoform
• Accession No. P56741
• UniprotP56741
• Gene ID295929;
• Calculated MW 26.1 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence PKIHLDCPGSTPDTIVVVAGNKLRLDVPISGDPAPTVIWQKTITQGKKASAGPPPGAPEDAGADEEWVFDKKLLCETEGRVRVETTKDRSVFTVEGAEKEDEGVYTVTVKNPVGEDQVNLTVKVIDVPDAPAAPKISNVGEDSCIVQWEPPAYDGGQPVLGYILERKKKKSYRWMRLNFDLLRELSHEARRMIEGVAYEMRVYAVNAVGMSRPSPASQPF
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role.

Mural R.J., Adams M.D., Myers E.W., Smith H.O., Venter J.C.Cardiac myosin-binding protein C (MyBP-C) identification of protein kinase A and protein kinase C phosphorylation sites.Mohamed A.S., Dignam J.D., Schlender K.K.Arch. Biochem. Biophys. 358:313-319(1998)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting