• Product NameRecombinant Rattus norvegicus Major prion protein
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:29-231aa
  Sequence Info:Full Length
• Alternative Names    CD230
• Accession No. P13852
• UniprotP13852
• Gene ID24686;
• Calculated MW 24.3 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence GGWNTGGSRYPGQGSPGGNRYPPQSGGTWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWSQGGGTHNQWNKPSKPKTNLKHVAGAAAAGAVVGGLGGYMLGSAMSRPMLHFGNDWEDRYYRENMYRYPNQVYYRPVDQYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCVTQYQKESQAYYDGRRS
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

May play a role in neuronal development and synaptic plasticity. May be required for neuronal myelin sheath maintenance. May play a role in iron uptake and iron homeostasis. Soluble oligomers are toxic to cultured neuroblastoma cells and induce apoptosis (in vitro). Association with GPC1 (via its heparan sulfate chains) targets PRNP to lipid rafts. Also provides Cu2+ or ZN2+ for the ascorbate-mediated GPC1 deaminase degradation of its heparan sulfate side chains .

Analysis of 27 mammalian and 9 avian PrPs reveals high conservation of flexible regions of the prion protein.Wopfner F., Weidenhofer G., Schneider R., von Brunn A., Gilch S., Schwarz T.F., Werner T., Schatzl H.M.J. Mol. Biol. 289:1163-1178(1999)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting