• Product NameRecombinant human Receptor-type tyrosine-protein phosphatase zeta
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:36-300aa
  Sequence Info:Partial
• Alternative Names    Protein-tyrosine phosphatase receptor type Z polypeptide 1;Protein-tyrosine phosphatase receptor type Z polypeptide 2R-PTP-zeta-2
• Accession No. P23471
• UniprotP23471
• Gene ID5803;
• Calculated MW 32.1 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence IGWSYTGALNQKNWGKKYPTCNSPKQSPINIDEDLTQVNVNLKKLKFQGWDKTSLENTFIHNTGKTVEINLTNDYRVSGGVSEMVFKASKITFHWGKCNMSSDGSEHSLEGQKFPLEMQIYCFDADRFSSFEEAVKGKGKLRALSILFEVGTEENLDFKAIIDGVESVSRFGKQAALDPFILLNLLPNSTDKYYIYNGSLTSPPCTDTVDWIVFKDTVSISESQLAVFCEVLTMQQSGYVMLMDYLQNNFREQQYKFSRQVFSSY
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Protein tyrosine phosphatase that negatively regulates oligodendrocyte precursor proliferation in the bryonic spinal cord. Required for normal differentiation of the precursor cells into mature, fully myelinating oligodendrocytes. May play a role in protecting oligondendrocytes against apoptosis. May play a role in the establishment of contextual mory, probably via the dephosphorylation of proteins that are part of important signaling cascades .

A human transmembrane protein-tyrosine-phosphatase, PTP zeta, is expressed in brain and has an N-terminal receptor domain homologous to carbonic anhydrases.Krueger N.X., Saito H.Proc. Natl. Acad. Sci. U.S.A. 89:7417-7421(1992)
Research Topic:Neuroscience

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting