• Product NameRecombinant Ovis aries Protransforming growth factor alpha
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:24-97aa
  Sequence Info:Extracellular Domain
• Alternative Names    EGF-like TGF Short name: ETGF TGF type 1
• Accession No. P98135
• UniprotP98135
• Calculated MW 34.9 kDa
• Tag Info N-terminal GST-tagged
• Target Sequence ENSTSALSDPPVAAAVVSHFNDCPDSHTQFCFHGTCRFLLQEEKPACVCHSGYVGARCEHADLLAVVAASQKKQ
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

TGF alpha is a mitogenic polypeptide that is able to bind to the EGF receptor,EGFR and to act synergistically with TGF beta to promote anchorage-independent cell proliferation in soft agar

"Growth factor expression in skin during wool follicle development."Sutton R., Ward W.G., Raphael K.A., Cam G.R.Comp. Biochem. Physiol. 110B:697-705(1995)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting