• Product NameRecombinant sheep Tumor necrosis factor
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:78-234aa
  Sequence Info:Partial
• Alternative Names    Cachectin;TNF-alphaTumor necrosis factor ligand superfamily member 2 ;TNF-a
• Accession No. P23383
• UniprotP23383
• Gene ID443540;
• Calculated MW 19.2 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence LRSSSQASNNKPVAHVVANISAPGQLRWGDSYANALMANGVELKDNQLVVPTDGLYLIYSQVLFRGHGCPSTPLFLTHTISRIAVSYQTKVNILSAIKSPCHRETLEGAEAKPWYEPIYQGGVFQLEKGDRLSAEINLPEYLDYAESGQVYFGIIAL
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Cytokine that binds to TNFRSF1A,TNFR1 and TNFRSF1B,TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct action or by stimulation of interleukin-1 secretion and is implicated in the induction of cachexia, Under certain conditions it can stimulate cell proliferation and induce cell differentiation.The TNF intracellular domain (ICD) form induces IL12 production in dendritic cells.

Molecular cloning, expression and characterization of ovine TNF alpha.Andrews A.E., Nash A.D., Barcham G.J., Brandon M.R.Immunol. Cell Biol. 69:273-283(1991)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting