- Product NameRecombinant Putative defensin-like protein 70
- Brief DescriptionRecombinant Protein
- Host SpeciesYeast
- PurificationGreater than 90% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region:28-82aa
Sequence Info:Full Length - Alternative Names Putative low-molecular-weight cysteine-rich protein 83 Short name: Protein LCR83
- Accession No. P82792
- UniprotP82792
- Gene ID3771507;
- Calculated MW 32.9 kDa
- Tag Info N-terminal GST-tagged
- Target Sequence NFASGEASSQLCFNPCTPQLGNNECNTICMNKKYKEGSCVGFGIPPTSKYCCCKT
- Formulation Tris-based buffer50% glycerol
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
