• Product NameRecombinant Geobacillus stearothermophilus Gellan lyase
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-204aa
  Sequence Info:Full Length
• Accession No. P85513
• UniprotP85513
• Calculated MW 22.5 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence LVSESNPGRAIPAGGKGATIRAARPGLATTLNGPKAGNGTTGATKLTTPARPLSEGANMMCDHRAGGNAAISGSSVGEGTARAGDSKVMSRMLSPKGSIIAGTVNMMPADIAAGSVRTPSSLPPDGRSATPMSVSEVASDISHKDGSVNVTKDPVTAAGLTAMRKNANKGSPPASPLPLKADNKGVHINKHWVDLKNDNDFNTR
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Cleaves the glycosidic bonds of gellan backbone and releases tetrasaccharide units of glucuronyl-glucosyl-rhamnosyl-glucose with unsaturated glucuronic acid at the non-reducing terminal. The enzyme is highly specific to the heteropolysaccharide gellan.

Primary structure analysis of a purified thermostable gellan lyase produced by Bulgarian geothermal spring inhabitant Geobacillus stearothermophilus 98.Atanassova M., Rodriguez-Alonso P., Garabal J.I., Derekova A., Terziiska A., Mandeva R., Kambourova M.Eur. J. Biochem. 0:0-0(2008)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting