• Product NameRecombinant Dactylis glomerata Pollen allergen Dac g 3
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-96aa
  Sequence Info:Full Length
• Alternative Names    Allergen Dac g III Allergen: Dac g 3
• Accession No. P93124
• UniprotP93124
• Calculated MW 12.9 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence VKVTFKVEKGSDPKKLVLDIKYTRPGDTLAEVELRQHGSEEWEPLTKKGNLWEVKSSKPLTGPFNFRFMSKGGMRNVFDEVIPTAFKIGTTYTPEE
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

0

"Cloning, sequencing and immunological characterization of Dac g 3, a major allergen from Dactylis glomerata pollen."Guerin-Marchand C., Senechal H., Bouin A.P., Leduc-Brodard V., Taudou G., Weyer A., Peltre G., David B.Mol. Immunol. 33:797-806(1996)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting