• Product NameRecombinant Envelope glycoprotein H
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:24-195aa
  Sequence Info:Partial
• Accession No. P12824
• UniprotP12824
• Calculated MW 21.8 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence RYGADAASEALDPHAFHLLLNTYGRPIRFLRENTTQCTYNSSLRNSTVVRENAISFNFFQSYNQYYVFHMPRCLFAGPLAEQFLNQVDLTETLERYQQRLNTYALVSKDLASYRSFSQQLKAQDSLGQQPTTVPPPIDLSIPHVWMPPQTTPHDWKGSHTTSGLHRPHFNQT
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

The heterodimer glycoprotein H-glycoprotein L is required for the fusion of viral and plasma mbranes leading to virus entry into the host cell. Mbrane fusion is mediated by the fusion machinery composed at least of gB and the heterodimer gH,gL . Fusion of with fibroblasts requires the additional receptor-binding protein gO, which forms a complex with gH,gL.

Identification and expression of a human cytomegalovirus glycoprotein with homology to the Epstein-Barr virus BXLF2 product, varicella-zoster virus gpIII, and herpes simplex virus type 1 glycoprotein H.Cranage M.P., Smith G.L., Bell S.E., Hart H., Brown C., Bankier A.T., Tomlinson P., Barrell B.G., Minson T.C.J. Virol. 62:1416-1422(1988)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting