• Product NameRecombinant Escherichia coli 8-oxo-dGTP diphosphatase
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1-129aa
  Sequence Info:Full Length
• Alternative Names    7,8-dihydro-8-oxoguanine-triphosphatase;Mutator protein MutTdGTP pyrophosphohydrolase
• Accession No. P08337
• UniprotP08337
• Gene ID944824;
• Calculated MW 16.9 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence MKKLQIAVGIIRNENNEIFITRRAADAHMANKLEFPGGKIEMGETPEQAVVRELQEEVGITPQHFSLFEKLEYEFPDRHITLWFWLVERWEGEPWGKEGQPGEWMSLVGLNADDFPPANEPVIAKLKRL
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Involved in the GO syst responsible for roving an oxidatively damaged form of guanine (7,8-dihydro-8-oxoguanine) from DNA and the nucleotide pool. 8-oxo-dGTP is inserted opposite dA and dC residues of tplate DNA with almost equal efficiency thus leading to A.T to G.C transversions. MutT specifically degrades 8-oxo-dGTP to the monophosphate.

Characterization of the mutT nucleoside triphosphatase of Escherichia coli.Bhatnagar S.K., Bullions L.C., Bessman M.J.J. Biol. Chem. 266:9050-9054(1991)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting