• Product NameRecombinant Pesticidal crystal protein cry1Ab
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:1022-1155aa
  Sequence Info:Partial
• Alternative Names    130KDA crystal protein;Crystaline entomocidal protoxinInsecticidal delta-endotoxin CryIA(b)
• Accession No. P0A370
• UniprotP0A370
• Calculated MW 17.3 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence HEIENNTDELKFSNCVEEEVYPNNTVTCNDYTATQEEYEGTYTSRNRGYDGAYESNSSVPADYASAYEEKAYTDGRRDNPCESNRGYGDYTPLPAGYVTKELEYFPETDKVWIEIGETEGTFIVDSVELLLMEE
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Promotes colloidosmotic lysis by binding to the midgut epithelial cells of many lepidopteran larvae.

Characterization of Bacillus thuringiensis subsp. kurstaki strain S93 effective against the Fall armyworm, Spodoptera frugiperda and cloning of a cry1Ab gene.Silva-Werneck J.O., De-Souza M.T., Dias J.M.C.S., Ribeiro B.M.Can. J. Microbiol. 45:464-471(1999)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting