• Product NameRecombinant human Guanylate cyclase activator 2B
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:27-112aa
  Sequence Info:Full Length
• Alternative Names    Guanylate cyclase C-activating peptide II ;GCAP-IIUroguanylin ;UGN
• Accession No. Q16661
• UniprotQ16661
• Gene ID2981;
• Calculated MW 11.5 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence VYIQYQGFRVQLESMKKLSDLEAQWAPSPRLQAQSLLPAVCHHPALPQDLQPVCASQEASSIFKTLRTIANDDCELCVNVACTGCL
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Endogenous activator of intestinal guanylate cyclase. It stimulates this enzyme through the same receptor binding region as the heat-stable enterotoxins. May be a potent physiological regulator of intestinal fluid and electrolyte transport. May be an autocrine,paracrine regulator of intestinal salt and water transport.

Cloning and characterization of a cDNA encoding a precursor for human uroguanylin.Miyazato M., Nakazato M., Yamaguchi H., Date Y., Kojima M., Kangawa K., Matsuo H., Matsukura S.Biochem. Biophys. Res. Commun. 219:644-648(1996)
Research Topic:Signal Transduction

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting