• Product NameRecombinant Staphylococcus aureus Alpha-hemolysin
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:27-319aa
  Sequence Info:Full Length
• Alternative Names    Alpha-toxin
• Accession No. Q2G1X0
• UniprotQ2G1X0
• Gene ID3920722;
• Calculated MW 35.3 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence ADSDINIKTGTTDIGSNTTVKTGDLVTYDKENGMHKKVFYSFIDDKNHNKKLLVIRTKGTIAGQYRVYSEEGANKSGLAWPSAFKVQLQLPDNEVAQISDYYPRNSIDTKEYMSTLTYGFNGNVTGDDTGKIGGLIGANVSIGHTLKYVQPDFKTILESPTDKKVGWKVIFNNMVNQNWGPYDRDSWNPVYGNQLFMKTRNGSMKAADNFLDPNKASSLLSSGFSPDFATVITMDRKASKQQTNIDVIYERVRDDYQLHWTSTNWKGTNTKDKWIDRSSERYKIDWEKEEMTN
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Alpha-toxin binds to the mbrane of eukaryotic cells resulting in the release of low-molecular weight molecules and leading to an eventual osmotic lysis. Heptamer oligomerization and pore formation is required for lytic activity .

Synthetic effects of secG and secY2 mutations on exoproteome biogenesis in Staphylococcus aureus.Sibbald M.J., Winter T., van der Kooi-Pol M.M., Buist G., Tsompanidou E., Bosma T., Schafer T., Ohlsen K., Hecker M., Antelmann H., Engelmann S., van Dijl J.M.J. Bacteriol. 192:3788-3800(2010)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting