• Product NameRecombinant mouse Scavenger receptor cysteine-rich type 1 protein M130
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:86-365aa
  Sequence Info:Partial
• Alternative Names    CD163
• Accession No. Q2VLH6
• UniprotQ2VLH6
• Gene ID93671;
• Calculated MW 32.2 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence VVCQQLGCPTSIKALGWANSSAGSGYIWMDKVSCTGNESALWDCKHDGWGKHNCTHEKDAGVTCSDGSNLEMRLVNSAGHRCLGRVEIKFQGKWGTVCDDNFSKDHASVICKQLGCGSAISFSGSAKLGAGSGPIWLDDLACNGNESALWDCKHRGWGKHNCDHAEDVGVICLEGADLSLRLVDGVSRCSGRLEVRFQGEWGTVCDDNWDLRDASVVCKQLGCPTAISAIGRVNASEGSGQIWLDNISCEGHEATLWECKHQEWGKHYCHHREDAGVTCS
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Involved in clearance and endocytosis of hoglobin,haptoglobin complexes by macrophages and may thereby protect tissues from free hoglobin-mediated oxidative damage. May play a role in the uptake and recycling of iron, via endocytosis of hoglobin,haptoglobin and subsequent breakdown of he. Binds hoglobin,haptoglobin complexes in a calcium-dependent and pH-dependent manner. Induces a cascade of intracellular signals that involves tyrosine kinase-dependent calcium mobilization, inositol triphosphate production and secretion of IL6 and CSF1 .After shedding, the soluble form (sCD163) may play an anti-inflammatory role.

Molecular cloning and characterization of the mouse CD163 homologue, a highly glucocorticoid-inducible member of the scavenger receptor cysteine-rich family.Schaer D.J., Boretti F.S., Hongegger A., Poehler D., Linnscheid P., Staege H., Mueller C., Schoedon G., Schaffner A.Immunogenetics 53:170-177(2001)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting