- Product NameRecombinant Human Erythropoietin protein(EPO)
- Brief DescriptionRecombinant Protein
- Host SpeciesMammalian cell
- Purification>98% as determined by SDS-PAGE and HPLC.
- Biological ActivityFully biologically active when compared to standard. The Specific Activity was measured by the stimulation of reticulocyte production in normocyth-aemic mice and was found to be no less than 1.5 105 IU,mg.
- Immunogen DescriptionExpression Region:28-193aa
Sequence Info:Full Length of Mature Protein - Alternative Names Epoetin,
- Accession No. P01588
- UniprotP01588
- Gene ID2056;
- Calculated MW 21.0 kDa
- Tag Info NO-tagged
- Target Sequence APPRLICDSRVLERYLLEAKEAENITTGCAEHCSLNENITVPDTKVNFYAWKRMEVGQQAVEVWQGLALLSEAVLRGQALLVNSSQPWEPLQLHVDKAVSGLRSLTTLLRALGAQKEAISPPDAASAAPLRTITADTFRKLFRVYSNFLRGKLKLYTGEACRTGDR
- Formulation Sterile filtered sodium citrate buffer (1 liter of ddH2O containing 5.9 g of sodium citrate, 5.8 g of sodium chloride and 0.06 g of citric acid), liquid
-
Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.
