• Product NameRecombinant Bovine Agouti-signaling protein(ASIP)
• Brief DescriptionRecombinant Protein
• Host SpeciesE.coli
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:23-133aa
  Sequence Info:Full Length
• Alternative Names    Agouti switch protein
• Accession No. Q29414
• UniprotQ29414
• Gene ID404192;
• Calculated MW 28.4 kDa
• Tag Info N-terminal 6xHis-SUMO-tagged
• Target Sequence HLAPEEKPRDERNLKNNSSMNLLDFPSVSIVALNKKSKKISRNEAEKKKRPSKRKAPMKNVARTRPPPPTPCVATRDSCKPPAPACCDPCAFCQCRFFRSACSCRVLNPTC
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Involved in the regulation of melanogenesis. The binding of ASP to MC1R precludes alpha-MSH initiated signaling and thus blocks production of cAMP, leading to a down-regulation of eumelanogenesis (brown,black pigment) and thus increasing synthesis of pheomelanin (yellow,red pigment)

"Widespread expression of the bovine Agouti gene results from at least three alternative promoters."Girardot M., Martin J., Guibert S., Leveziel H., Julien R., Oulmouden A.Pigment Cell Res. 18:34-41(2005)
Research Topic:Neuroscience

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting