- Product NameRecombinant Human ATP-binding cassette sub-family G member 2(ABCG2)
- Host SpeciesYeast
- Immunogen DescriptionExpression Region: 557-630aa Sequence Info:Partial
- Alternative Names ABCG2; ABCP; BCRP; BCRP1; MXR; Broad substrate specificity ATP-binding cassette transporter ABCG2; ATP-binding cassette sub-family G member 2; Breast cancer resistance protein; CDw338; Mitoxantrone resistance-associated protein; Placenta-specific ATP-binding cassette transporter; Urate exporter; CD antigen CD338
- Accession No. Q9UNQ0
- Target Species Homo sapiens (Human)
- SDS-PAGE MW 12.1 kDa
- Tag Info C-terminal 6xHis-Myc-tagged
- Target Sequence NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH
- Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
