- Product NameRecombinant Human NACHT, LRR and PYD domains-containing protein 3(NLRP3),partial
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- PurificationGreater than 85% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region: 733-1036aa Sequence Info:partial
- Target NameNLRP3
- Alternative Names (Angiotensin/vasopressin receptor AII/AVP-like)(Caterpiller protein 1.1)(CLR1.1)(Cold-induced autoinflammatory syndrome 1 protein)(Cryopyrin)(PYRIN-containing APAF1-like protein 1)
- Accession No. Q96P20
- Target Species Homo sapiens (Human)
- Calculated MW 40.7 kDa
- Tag Info N-terminal 10xHis-tagged and C-terminal Myc-tagged
- Target Sequence LFSVLSTSQSLTELDLSDNSLGDPGMRVLCETLQHPGCNIRRLWLGRCGLSHECCFDISLVLSSNQKLVELDLSDNALGDFGIRLLCVGLKHLLCNLKKLWLVSCCLTSACCQDLASVLSTSHSLTRLYVGENALGDSGVAILCEKAKNPQCNLQKLGLVNSGLTSVCCSALSSVLSTNQNLTHLYLRGNTLGDKGIKLLCEGLLHPDCKLQVLELDNCNLTSHCCWDLSTLLTSSQSLRKLSLGNNDLGDLGVMMFCEVLKQQSCLLQNLGLSEMYFNYETKSALETLQEEKPELTVVFEPSW
- Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
