- Product NameRecombinant Human Gap junction alpha-5 protein(GJA5),partial
- Brief DescriptionRecombinant Protein
- Host SpeciesE.coli
- Purification>85% (SDS-PAGE)
- Immunogen DescriptionExpression Region:227-358aa Sequence Info:Partial
- Alternative Names GJA5; Gap junction alpha-5 protein; Connexin-40; Cx40
- Accession No. P36382
- Target Species Homo sapiens (Human)
- Tag Info N-terminal His-tagged
- Target Sequence YHLGWKKIRQRFVKPRQHMAKCQLSGPSVGIVQSCTPPPDFNQCLENGPGGKFFNPFSNNMASQQNTDNLVTEQVRGQEQTPGEGFIQVRYGQKPEVPNGVSPGHRLPHGYHSDKRRLSKASSKARSDDLSV
- Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
