- Product NameRecombinant Human Clusterin(CLU)
- Brief DescriptionRecombinant Protein
- Host SpeciesMammalian Cell
- PurificationGreater than 85% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region: 23-449aa Sequence Info:Full Length of Mature Protein
- Target NameHis-tagged
- Alternative Names (Aging-associated gene 4 protein)(Apolipoprotein J)(Apo-J)(Complement cytolysis inhibitor)(CLI)(Complement-associated protein SP-40,40)(Ku70-binding protein 1)(NA1/NA2)(Sulfated glycoprotein 2)(SGP-2)(Testosterone-repressed prostate message 2)(TRPM-2)
- Accession No. P10909
- Target Species Homo sapiens (Human)
- SDS-PAGE MW 52.3 kDa
- Tag Info C-terminal 6xHis-tagged
- Target Sequence DQTVSDNELQEMSNQGSKYVNKEIQNAVNGVKQIKTLIEKTNEERKTLLSNLEEAKKKKEDALNETRESETKLKELPGVCNETMMALWEECKPCLKQTCMKFYARVCRSGSGLVGRQLEEFLNQSSPFYFWMNGDRIDSLLENDRQQTHMLDVMQDHFSRASSIIDELFQDRFFTREPQDTYHYLPFSLPHRRPHFFFPKSRIVRSLMPFSPYEPLNFHAMFQPFLEMIHEAQQAMDIHFHSPAFQHPPTEFIREGDDDRTVCREIRHNSTGCLRMKDQCDKCREILSVDCSTNNPSQAKLRRELDESLQVAERLTRKYNELLKSYQWKMLNTSSLLEQLNEQFNWVSRLANLTQGEDQYYLRVTTVASHTSDSDVPSGVTEVVVKLFDSDPITVTVPVEVSRKNPKFMETVAEKALQEYRKKHREE
- Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
