- Product NameRecombinant Chicken Avidin(AVD)
- Brief DescriptionRecombinant Proteins
- Host SpeciesYeast
- PurificationGreater than 85% as determined by SDS-PAGE.
- Immunogen DescriptionExpression Region: 25-152aa Sequence Info:Full Length of Mature Protein
- Target NameHis-tagged
- Accession No. P02701
- Target Species Gallus gallus (Chicken)
- Calculated MW 15.8 kDa
- Tag Info C-terminal 6xHis-tagged
- Target Sequence ARKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHGTQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRSSVNDIGDDWKATRVGINIFTRLRTQKE
- Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
