- Product NameRecombinant Hirudin
- Purification> 96 % HPLC analyses.
- Biological ActivityTesting in progress.
- EndotoxinLess than 0.1 EU/ugof rHirudin as determined by LAL method.
- Target Sequence LTVVYTDCTESGQNLCLCEGSNVCGQGNKCILGSDGEKNQCVTGEGTPGPQSHNDGDFEEP EEYL
- Formulation Lyophilized from a 0.2 μm filtered solution of 20 mM PB, pH 7.0, containing 2 % mannitol.
- Storage Use a manual defrost freezer and avoid repeated freeze-thaw cycles.1. 12 months from date of receipt, -20 to -70 ˚C as supplied. 2. 1 month, 2 to 8 ˚C under sterile conditions after reconstitution.3. 3 months, -20 to -70 ˚C under sterile conditions after reconstitution.
