• Product NameRecombinant Calloselasma rhodostoma Snaclec rhodocytin subunit beta
• Brief DescriptionRecombinant Protein
• Host SpeciesYeast
• PurificationGreater than 90% as determined by SDS-PAGE.
• Immunogen DescriptionExpression Region:24-146aa
  Sequence Info:Full Length
• Alternative Names    Aggretin beta chain Rhodoaggretin subunit beta
• Accession No. Q9I840
• UniprotQ9I840
• Calculated MW 16.4 kDa
• Tag Info N-terminal 6xHis-tagged
• Target Sequence DCPSGWSSYEGHCYKPFNEPKNWADAERFCKLQPKHSHLVSFQSAEEADFVVKLTRPRLKANLVWMGLSNIWHGCNWQWSDGARLNYKDWQEQSECLAFRGVHTEWLNMDCSSTCSFVCKFKA
• Formulation Tris-based buffer50% glycerol
• Storage The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20˚C,-80˚C. The shelf life of lyophilized form is 12 months at -20˚C,-80˚C.
  Notes:Repeated freezing and thawing is not recommended. Store working aliquots at 4˚C for up to one week.

Elicits platelet aggregation by the binding to the C-type lectin domain family 1 member B (CLEC1B,CLEC2). Binding leads to tyrosine phosphorylation in the Cytoplasmic domain tail of CLEC1B, which promotes the binding of spleen tyrosine kinase (Syk), subsequent activation of PLCgamma2, and platelet activation and aggregation. Binding to GPIbalpha (GP1BA) and alpha2,beta-1 (ITGA2,ITGB1) may also induce aggregation, but this is controversial.

Molecular cloning and sequence analysis of aggretin, a collagen-like platelet aggregation inducer.Chung C.-H., Au L.-C., Huang T.-F.Biochem. Biophys. Res. Commun. 263:723-727(1999)
Research Topic:Others

• Flow Cytometry (FCM) General Protocol
• Immunofluorescence(IC)
• Immunohistochemistry(Polymer)
• Western Blotting